Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea3 Peptide - C-terminal region

Tcea3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S-II, SII-K1

UniProt

P23881

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea3 Rabbit Polyclonal Antibody (orb580111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035672

Preservative

Lyophilized powder

AA Sequence

LKDPRNPGLRRNVLSGAISPELIAKMTAEEMASDELRELRNAMTQEAIRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 5-Cyanopicolinate
TRC-E410510-500MG 500 mg

Ethyl 5-Cyanopicolinate

Sign In for Pricing
View Details
GARS1 Human Knockdown Lysate
LY300171 100 µg

GARS1 Human Knockdown Lysate

Sign In for Pricing
View Details
Timm8a2 Mouse Gene Knockout Kit (CRISPR)
KN517582 1 Kit

Timm8a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APOL2 Polyclonal Antibody
E-AB-90371-01 60 µL

APOL2 Polyclonal Antibody

Sign In for Pricing
View Details
APOL2 Polyclonal Antibody
E-AB-90371-02 120 µL

APOL2 Polyclonal Antibody

Sign In for Pricing
View Details
APOL2 Polyclonal Antibody
E-AB-90371-03 200 µL

APOL2 Polyclonal Antibody

Sign In for Pricing
View Details