Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea3 Peptide - C-terminal region

Tcea3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

S-II, SII-K1

UniProt

P23881

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea3 Rabbit Polyclonal Antibody (orb580111) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035672

Preservative

Lyophilized powder

AA Sequence

LKDPRNPGLRRNVLSGAISPELIAKMTAEEMASDELRELRNAMTQEAIRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM-CSF Antibody
KC-059-01 50 μL

GM-CSF Antibody

Sign In for Pricing
View Details
GM-CSF Antibody
KC-059-02 100 µL

GM-CSF Antibody

Sign In for Pricing
View Details
GM-CSF Antibody
KC-059-03 1 mL

GM-CSF Antibody

Sign In for Pricing
View Details
Orbital Shaker BSOT-604
BSOT-604 Each

Orbital Shaker BSOT-604

Sign In for Pricing
View Details
PRA1 (RABAC1) Human Gene Knockout Kit (CRISPR)
KN401112 1 Kit

PRA1 (RABAC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), 0.2mg/mL
BNUB3042-100 1x 100 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), 0.2mg/mL

Sign In for Pricing
View Details