Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF20 Peptide - C-terminal region

TCF20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AR1, KIAA0292, SPBP

UniProt

Q9UGU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCF20 Rabbit Polyclonal Antibody (orb324767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005641

Preservative

Lyophilized powder

AA Sequence

HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Was (NM_001108248) Rat Tagged Lenti ORF Clone
RR213425L3 10 µg

Was (NM_001108248) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
mmu-miR-466q miRNA Inhibitor
MIM02129 2x 5.0 nmol

mmu-miR-466q miRNA Inhibitor

Sign In for Pricing
View Details
Human CDH19/Cadherin-19 Antibody , FITC
E55A07903 50 Tests

Human CDH19/Cadherin-19 Antibody , FITC

Sign In for Pricing
View Details
Galnt11 (NM_144908) Mouse Tagged ORF Clone
MR209375 10 µg

Galnt11 (NM_144908) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
3 x Charcoal Stripped Serum
MBS173596-01 1 L

3 x Charcoal Stripped Serum

Sign In for Pricing
View Details
3 x Charcoal Stripped Serum
MBS173596-02 5x 1 L

3 x Charcoal Stripped Serum

Sign In for Pricing
View Details