Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF20 Peptide - C-terminal region

TCF20 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AR1, KIAA0292, SPBP

UniProt

Q9UGU0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCF20 Rabbit Polyclonal Antibody (orb324767) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005641

Preservative

Lyophilized powder

AA Sequence

HYPCAIDADCLLHEENFSVRCPKHKPPLPCPLPPLQNKTAKGSLSTEQSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFSWAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43600111 3x 1.0 µg

SFSWAP sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PTPRC, NT (PTPRC, CD45, Receptor-type tyrosine-protein phosphatase C, Leukocyte common antigen, T200, CD45) (PE)
MBS6339040-01 0.2 mL

PTPRC, NT (PTPRC, CD45, Receptor-type tyrosine-protein phosphatase C, Leukocyte common antigen, T200, CD45) (PE)

Sign In for Pricing
View Details
PTPRC, NT (PTPRC, CD45, Receptor-type tyrosine-protein phosphatase C, Leukocyte common antigen, T200, CD45) (PE)
MBS6339040-02 5x 0.2 mL

PTPRC, NT (PTPRC, CD45, Receptor-type tyrosine-protein phosphatase C, Leukocyte common antigen, T200, CD45) (PE)

Sign In for Pricing
View Details
Abca5 (NM_147219) Mouse Untagged Clone
MC224780 10 µg

Abca5 (NM_147219) Mouse Untagged Clone

Sign In for Pricing
View Details
Gadd45gip1 Mouse shRNA Lentiviral Particle (Locus ID 102060)
TL505639V 500 µL Each

Gadd45gip1 Mouse shRNA Lentiviral Particle (Locus ID 102060)

Sign In for Pricing
View Details
Olr468 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV637706 1.0 µg DNA

Olr468 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details