Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcn2 Peptide - N-terminal region

Tcn2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW208754, Tcn-2

UniProt

O88968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcn2 Rabbit Polyclonal Antibody (orb580299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056564

Preservative

Lyophilized powder

AA Sequence

PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPN1 (NM_001308) Human Over-expression Lysate
LC420016 20 µg

CPN1 (NM_001308) Human Over-expression Lysate

Sign In for Pricing
View Details
7-Hydroxy-1-indanone
TRC-H953823-50MG 50 mg

7-Hydroxy-1-indanone

Sign In for Pricing
View Details
Anti- SR-B1
Y058459 100 µL

Anti- SR-B1

Sign In for Pricing
View Details
EXTL2 Rabbit Polyclonal Antibody
TA362175 100 µL

EXTL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTBP2 Rabbit Polyclonal Antibody
AP20425PU-N 100 µg

CTBP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS507155 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details