Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcn2 Peptide - N-terminal region

Tcn2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW208754, Tcn-2

UniProt

O88968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcn2 Rabbit Polyclonal Antibody (orb580299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056564

Preservative

Lyophilized powder

AA Sequence

PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CXCL5 Antibody
RC-15033-01 50 μL

Recombinant CXCL5 Antibody

Sign In for Pricing
View Details
Recombinant CXCL5 Antibody
RC-15033-02 100 µL

Recombinant CXCL5 Antibody

Sign In for Pricing
View Details
Recombinant CXCL5 Antibody
RC-15033-03 1 mL

Recombinant CXCL5 Antibody

Sign In for Pricing
View Details
Recombinant Human FGF23 protein (SUMO, His tag)
PDEH100848-01 20 µg

Recombinant Human FGF23 protein (SUMO, His tag)

Sign In for Pricing
View Details
Recombinant Human FGF23 protein (SUMO, His tag)
PDEH100848-02 100 µg

Recombinant Human FGF23 protein (SUMO, His tag)

Sign In for Pricing
View Details
Recombinant Human FGF23 protein (SUMO, His tag)
PDEH100848-03 500 µg

Recombinant Human FGF23 protein (SUMO, His tag)

Sign In for Pricing
View Details