Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcn2 Peptide - N-terminal region

Tcn2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW208754, Tcn-2

UniProt

O88968

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcn2 Rabbit Polyclonal Antibody (orb580299) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056564

Preservative

Lyophilized powder

AA Sequence

PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTDSP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]
TA502227AM 100 µL

CTDSP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details
Texas Red Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-
T-6601-1 1 mg

Texas Red Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560269 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Tissue Total RNA, Duodenum
CR563038 5 µg

Tissue Total RNA, Duodenum

Sign In for Pricing
View Details
C5ar2 Mouse Gene Knockout Kit (CRISPR)
KN302384BN 1 Kit

C5ar2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FZD8 Antibody
8G113-AAT 50 µg

FZD8 Antibody

Sign In for Pricing
View Details