Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Peptide - C-terminal region

TCP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha

UniProt

P17987

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP1 Rabbit Polyclonal Antibody (orb331238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110379

Preservative

Lyophilized powder

AA Sequence

QAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cat Perilipin 5 ELISA Kit
MBS093771 Inquire

Cat Perilipin 5 ELISA Kit

Sign In for Pricing
View Details
G protein alpha 13 Recombinant Rabbit mAb
orb2325346-01 25 µL

G protein alpha 13 Recombinant Rabbit mAb

Sign In for Pricing
View Details
G protein alpha 13 Recombinant Rabbit mAb
orb2325346-02 50 µL

G protein alpha 13 Recombinant Rabbit mAb

Sign In for Pricing
View Details
G protein alpha 13 Recombinant Rabbit mAb
orb2325346-03 100 µL

G protein alpha 13 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Lentiviral human ZNF26 sgRNA gene knockout kit - Lentiviral human ZNF26 sgRNA gene knockout kit (25)
GTR15370755 1 Vial

Lentiviral human ZNF26 sgRNA gene knockout kit - Lentiviral human ZNF26 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit IgG F(c) Antibody Fluorescein Conjugated
TA397283 20 mg

Rabbit IgG F(c) Antibody Fluorescein Conjugated

Sign In for Pricing
View Details