Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCP1 Peptide - C-terminal region

TCP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCT-alpha, CCT1, CCTa, D6S230E, TCP-1-alpha

UniProt

P17987

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCP1 Rabbit Polyclonal Antibody (orb331238) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110379

Preservative

Lyophilized powder

AA Sequence

QAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD2 Tail-binding Antibody
E034187 100 µg -100 µL

CD2 Tail-binding Antibody

Sign In for Pricing
View Details
Anti-HBD Antibody Picoband®
A01076-1 100 µg/Vial

Anti-HBD Antibody Picoband®

Sign In for Pricing
View Details
SMAD3 3'UTR GFP Stable Cell Line
TU073694 1.0 mL

SMAD3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor BB ELISA Kit
MBS721024-01 48 Well

Mouse Platelet Derived Growth Factor BB ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor BB ELISA Kit
MBS721024-02 96 Well

Mouse Platelet Derived Growth Factor BB ELISA Kit

Sign In for Pricing
View Details
Mouse Platelet Derived Growth Factor BB ELISA Kit
MBS721024-03 5x 96 Well

Mouse Platelet Derived Growth Factor BB ELISA Kit

Sign In for Pricing
View Details