Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1 Peptide - middle region

TDGF1 Peptide - middle region

Product Specifications

Product Name Alternative

CR, CRGF, CRIPTO, Cripto-1

UniProt

P13385

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDGF1 Rabbit Polyclonal Antibody (orb330414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003203

Preservative

Lyophilized powder

AA Sequence

LRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Y.Enterocolitica (O:9) YopH Protein
orb429260-01 50 µg

Y.Enterocolitica (O:9) YopH Protein

Sign In for Pricing
View Details
Y.Enterocolitica (O:9) YopH Protein
orb429260-02 100 µg

Y.Enterocolitica (O:9) YopH Protein

Sign In for Pricing
View Details
Y.Enterocolitica (O:9) YopH Protein
orb429260-03 1 mg

Y.Enterocolitica (O:9) YopH Protein

Sign In for Pricing
View Details
[KO Validated] NDUFS2 Rabbit pAb
E45R19471N-100 100 µL

[KO Validated] NDUFS2 Rabbit pAb

Sign In for Pricing
View Details
SQSTM1 Antibody
orb3167294 500 µL

SQSTM1 Antibody

Sign In for Pricing
View Details
Anti-PYROXD1 Antibody Picoband® (Biotine Conjugate)
A17214-4-Biotin 100 µg/Vial

Anti-PYROXD1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details