Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDGF1 Peptide - middle region

TDGF1 Peptide - middle region

Product Specifications

Product Name Alternative

CR, CRGF, CRIPTO, Cripto-1

UniProt

P13385

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TDGF1 Rabbit Polyclonal Antibody (orb330414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003203

Preservative

Lyophilized powder

AA Sequence

LRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLVGICLSIQSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD166 (ALCAM) (NM_001627) Human Tagged ORF Clone Lentiviral Particle
RC219251L3V 200 µL

CD166 (ALCAM) (NM_001627) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FOXQ1 discontinued
530708-01 20 µL

FOXQ1 discontinued

Sign In for Pricing
View Details
FOXQ1 discontinued
530708-02 100 µL

FOXQ1 discontinued

Sign In for Pricing
View Details
KCNK1 Rabbit Polyclonal Antibody
E10G31049 100 µL

KCNK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olfr720 Protein Vector (Mouse) (pPB-C-His)
PV211458 500 ng

Olfr720 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ULK1, ID (Serine/Threonine-protein Kinase ULK1, Unc-51-like Kinase 1, ATG1, KIAA0722)
U1500-70B 200 µL

ULK1, ID (Serine/Threonine-protein Kinase ULK1, Unc-51-like Kinase 1, ATG1, KIAA0722)

Sign In for Pricing
View Details