Tdp1 Peptide - middle region
Tdp1 Peptide - middle region
Product Specifications
Product Name Alternative
2810481F14Rik, 4921509N21Rik, AI838772, AW493413, E430034L06Rik, SCAN1, MLZ-501
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tdp1 Rabbit Polyclonal Antibody (orb326158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_082630
Preservative
Lyophilized powder
AA Sequence
ETNVYLIGSTPGRFQGSHRDNWGHFRLRKLLQAHAPSTPKGECWPIVGQF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
