Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tead4 Peptide - middle region

Tead4 Peptide - middle region

Product Specifications

Product Name Alternative

ETFR-2, Etfr2, FR-19, TEAD-4, TEF-3, Tcf13r1, Tef3, Tefr, Tefr1, Tefr1a

UniProt

Q62296

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tead4 Rabbit Polyclonal Antibody (orb574665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035697

Preservative

Lyophilized powder

AA Sequence

RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAP1GAP 3'UTR Luciferase Stable Cell Line
TU019503 1.0 mL

RAP1GAP 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse 2310057M21Rik qPCR Primer Pair
QM36034S 200 Tests

Mouse 2310057M21Rik qPCR Primer Pair

Sign In for Pricing
View Details
IKK Alpha + IKK beta Rabbit Polyclonal Antibody (Cy5.5)
orb1011837 100 µL

IKK Alpha + IKK beta Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
K2C80 Rabbit Polyclonal Antibody
JOT-AP10781-01 20 µL

K2C80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
K2C80 Rabbit Polyclonal Antibody
JOT-AP10781-02 50 μL

K2C80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
K2C80 Rabbit Polyclonal Antibody
JOT-AP10781-03 100 µL

K2C80 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details