Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tead4 Peptide - middle region

Tead4 Peptide - middle region

Product Specifications

Product Name Alternative

ETFR-2, Etfr2, FR-19, TEAD-4, TEF-3, Tcf13r1, Tef3, Tefr, Tefr1, Tefr1a

UniProt

Q62296

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tead4 Rabbit Polyclonal Antibody (orb574665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035697

Preservative

Lyophilized powder

AA Sequence

RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Annexin A1 (ANXA1) ELISA Kit
MBS2705618-01 24 Strip Well

Rabbit Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Annexin A1 (ANXA1) ELISA Kit
MBS2705618-02 48 Well

Rabbit Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Annexin A1 (ANXA1) ELISA Kit
MBS2705618-03 96 Well

Rabbit Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Annexin A1 (ANXA1) ELISA Kit
MBS2705618-04 5x 96 Well

Rabbit Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Rabbit Annexin A1 (ANXA1) ELISA Kit
MBS2705618-05 10x 96 Well

Rabbit Annexin A1 (ANXA1) ELISA Kit

Sign In for Pricing
View Details
Anti-Cytochrome P450 4X1 Antibody
MBS820973-01 0.03 mL

Anti-Cytochrome P450 4X1 Antibody

Sign In for Pricing
View Details