Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tekt3 Peptide - N-terminal region

Tekt3 Peptide - N-terminal region

Product Specifications

UniProt

Q4V8G8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tekt3 Rabbit Polyclonal Antibody (orb583662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001019910

Preservative

Lyophilized powder

AA Sequence

MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tide Fluor™ 7WS maleimide [TF7WS maleimide] *Superior replacement for Cy7*
2332-AAT 1 mg

Tide Fluor™ 7WS maleimide [TF7WS maleimide] *Superior replacement for Cy7*

Sign In for Pricing
View Details
1-Amino-4-cyclopentylpiperazine
TRC-A603548-50MG 50 mg

1-Amino-4-cyclopentylpiperazine

Sign In for Pricing
View Details
CD11c (ITGAX) (NM_000887) Human Over-expression Lysate
LC424468 20 µg

CD11c (ITGAX) (NM_000887) Human Over-expression Lysate

Sign In for Pricing
View Details
GFI1B Human Gene Knockout Kit (CRISPR)
KN419503 1 Kit

GFI1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ube2l6 Mouse Gene Knockout Kit (CRISPR)
KN518582 1 Kit

Ube2l6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GAD65 Recombinant Chimeric Antibody Antibody
HA601473 100 µL

GAD65 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details