Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tekt3 Peptide - N-terminal region

Tekt3 Peptide - N-terminal region

Product Specifications

UniProt

Q4V8G8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tekt3 Rabbit Polyclonal Antibody (orb583662) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001019910

Preservative

Lyophilized powder

AA Sequence

MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APMAP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]
TA504167AM 100 µL

APMAP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]

Sign In for Pricing
View Details
VEGFC Mouse Monoclonal Antibody [Clone ID: 107/A11]
AM33410BT-N 50 µg

VEGFC Mouse Monoclonal Antibody [Clone ID: 107/A11]

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-01 20 µg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-02 100 µg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-03 500 µg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human LEPTIN Protein (GST Tag)
PDEH101125-04 1 mg

Recombinant Human LEPTIN Protein (GST Tag)

Sign In for Pricing
View Details