Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERF2IP Peptide - middle region

TERF2IP Peptide - middle region

Product Specifications

Product Name Alternative

DRIP5, RAP1

UniProt

Q9NYB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TERF2IP Rabbit Polyclonal Antibody (orb583516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061848

Preservative

Lyophilized powder

AA Sequence

EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caenorhabditis Elegans ttr-2 Protein (aa 18-148)
VAng-Ly3871-500gEcoli 500 µg (E. coli)

Recombinant Caenorhabditis Elegans ttr-2 Protein (aa 18-148)

Sign In for Pricing
View Details
Complete Cell Lysis solution
CE203 5ml

Complete Cell Lysis solution

Sign In for Pricing
View Details
HNRPA1 Peptide - N-terminal region
orb2017691 100 µg

HNRPA1 Peptide - N-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal TACC2 Antibody (OTI3C4) [Janelia Fluor 646]
NBP2-74430JF646 0.1 mL

Mouse Monoclonal TACC2 Antibody (OTI3C4) [Janelia Fluor 646]

Sign In for Pricing
View Details
Rabbit Polyclonal RPA2 [p Ser4, p Ser8] Antibody [Alexa Fluor 647]
NBP1-23017AF647 0.1 mL

Rabbit Polyclonal RPA2 [p Ser4, p Ser8] Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Elbasvir (MK-8742) 2mg
A16855-2 2 mg

Elbasvir (MK-8742) 2mg

Sign In for Pricing
View Details