Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TES Peptide - middle region

TES Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp586B2022, MGC1146, TESS, TESS-2

UniProt

Q9UGI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TES Rabbit Polyclonal Antibody (orb585516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056456

Preservative

Lyophilized powder

AA Sequence

PKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA2 Knockout 769-P Polyclonal Cells
ARG35127 1 Million

GOLGA2 Knockout 769-P Polyclonal Cells

Sign In for Pricing
View Details
JAK2 Polyclonal Antibody
MBS2526246-01 0.02 mL

JAK2 Polyclonal Antibody

Sign In for Pricing
View Details
JAK2 Polyclonal Antibody
MBS2526246-02 0.06 mL

JAK2 Polyclonal Antibody

Sign In for Pricing
View Details
JAK2 Polyclonal Antibody
MBS2526246-03 0.12 mL

JAK2 Polyclonal Antibody

Sign In for Pricing
View Details
JAK2 Polyclonal Antibody
MBS2526246-04 0.2 mL

JAK2 Polyclonal Antibody

Sign In for Pricing
View Details
JAK2 Polyclonal Antibody
MBS2526246-05 5x 0.2 mL

JAK2 Polyclonal Antibody

Sign In for Pricing
View Details