Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TES Peptide - middle region

TES Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp586B2022, MGC1146, TESS, TESS-2

UniProt

Q9UGI8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TES Rabbit Polyclonal Antibody (orb585516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056456

Preservative

Lyophilized powder

AA Sequence

PKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD11b ITGAM Rabbit Monoclonal Antibody
M00144 100 µL/Vial

Anti-CD11b ITGAM Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Ntng1 Pre-designed siRNA Set A
SI109654A 1 Each

Mouse Ntng1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (MaxLight 750) discontinued
247037-ML750 100 µL

HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
A2M ORF Vector (Human) (pORF)
ORF015133 1.0 µg DNA

A2M ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GP9 protein (His tag)
80R-2623 100 ug

GP9 protein (His tag)

Sign In for Pricing
View Details
Canine Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit
MBS9394796-01 48 Well

Canine Thioredoxin Domain-Containing Protein 17 (TXNDC17) ELISA Kit

Sign In for Pricing
View Details