Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX14 Peptide - middle region

TEX14 Peptide - middle region

Product Specifications

Product Name Alternative

CT113

UniProt

Q8IWB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX14 Rabbit Polyclonal Antibody (orb582254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938207

Preservative

Lyophilized powder

AA Sequence

TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gp91-phox CRISPR/Cas9 KO Plasmid (h)
sc-400222 20 µg

Gp91-phox CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
IRAK1 antibody
70R-49924 100 ul

IRAK1 antibody

Sign In for Pricing
View Details
Mouse Monoclonal HDAC1 Antibody (PCRP-HDAC1-1B7) [DyLight 488]
NBP3-14062G 0.1 mL

Mouse Monoclonal HDAC1 Antibody (PCRP-HDAC1-1B7) [DyLight 488]

Sign In for Pricing
View Details
BRI3 (Brain Protein I3)
476373 100 µL

BRI3 (Brain Protein I3)

Sign In for Pricing
View Details
Polyclonal CACNB1 antibody - N-terminal region
APR00670G 0.05mg

Polyclonal CACNB1 antibody - N-terminal region

Sign In for Pricing
View Details
Wnt-1 Polyclonal Antibody
MBS8592832-01 0.1 mg

Wnt-1 Polyclonal Antibody

Sign In for Pricing
View Details