Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX14 Peptide - middle region

TEX14 Peptide - middle region

Product Specifications

Product Name Alternative

CT113

UniProt

Q8IWB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX14 Rabbit Polyclonal Antibody (orb582254) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_938207

Preservative

Lyophilized powder

AA Sequence

TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCRL4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0178103 1.0 µg DNA

BCRL4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ADAM22 (Extracellular) Antibody
abx442701 100 µg

ADAM22 (Extracellular) Antibody

Sign In for Pricing
View Details
EPHX2 Human siRNA Oligo Duplex (Locus ID 2053)
SR301434 1 Kit

EPHX2 Human siRNA Oligo Duplex (Locus ID 2053)

Sign In for Pricing
View Details
Lentiviral human ITGAE shRNA (UAS) - Lentiviral human ITGAE shRNA (UAS, GFP) plasmid
GTR15286942 1 Vial

Lentiviral human ITGAE shRNA (UAS) - Lentiviral human ITGAE shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
[1,1'-Biphenyl]-4-yl diethyl phosphate
OR1100804-01 250 mg

[1,1'-Biphenyl]-4-yl diethyl phosphate

Sign In for Pricing
View Details
[1,1'-Biphenyl]-4-yl diethyl phosphate
OR1100804-02 500 mg

[1,1'-Biphenyl]-4-yl diethyl phosphate

Sign In for Pricing
View Details