Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB2M Peptide - N-terminal region

TFB2M Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ22661, FLJ23182, Hkp1, mtTFB2

UniProt

Q9H5Q4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFB2M Rabbit Polyclonal Antibody (orb330060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071761

Preservative

Lyophilized powder

AA Sequence

MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pycrl Mouse shRNA Lentiviral Particle (Locus ID 66194)
TL503543V 500 µL Each

Pycrl Mouse shRNA Lentiviral Particle (Locus ID 66194)

Sign In for Pricing
View Details
AKIN11 Antibody
PHY7220S 150 μg

AKIN11 Antibody

Sign In for Pricing
View Details
EB-3
ABC-TC0233 1 Vial

EB-3

Sign In for Pricing
View Details
MIER1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1302808 1.0 µg DNA

MIER1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TRIM24 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
47757154 3x 1.0 µg DNA

TRIM24 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
(3,4-Difluorophenyl) (1-methyl-1H-imidazol-2-yl) methanamine
XMB01277-01 50 mg

(3,4-Difluorophenyl) (1-methyl-1H-imidazol-2-yl) methanamine

Sign In for Pricing
View Details