Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFB2M Peptide - N-terminal region

TFB2M Peptide - N-terminal region

Product Specifications

Product Name Alternative

FLJ22661, FLJ23182, Hkp1, mtTFB2

UniProt

Q9H5Q4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFB2M Rabbit Polyclonal Antibody (orb330060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071761

Preservative

Lyophilized powder

AA Sequence

MWIPVVGLPRRLRLSALAGAGRFCILGSEAATRKHLPARNHCGLSDSSPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri sufE Protein (aa 1-138)
VAng-Lsx08192-50gEcoli 50 µg (E. coli)

Recombinant Shigella Flexneri sufE Protein (aa 1-138)

Sign In for Pricing
View Details
PIPK I γ Lentiviral Activation Particles (m)
sc-422240-LAC 200 µL

PIPK I γ Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
1- (4,4'-Dichlorobenzhydryl) piperazine
sc-281911 2 g

1- (4,4'-Dichlorobenzhydryl) piperazine

Sign In for Pricing
View Details
Human VPS24 (CHMP3) activation kit by CRISPRa
GA109924 1 Kit

Human VPS24 (CHMP3) activation kit by CRISPRa

Sign In for Pricing
View Details
7-Amino-1,3,5-triazatricyclo[3.3.1.13,7]decane trihydrochloride
sc-319607 500 mg

7-Amino-1,3,5-triazatricyclo[3.3.1.13,7]decane trihydrochloride

Sign In for Pricing
View Details
Rabbit Human SPARC, conjugated with Biotin Antibody
orb109570 50 µg

Rabbit Human SPARC, conjugated with Biotin Antibody

Sign In for Pricing
View Details