Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFDP3 Peptide - N-terminal region

TFDP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CT30, E2F-like, HCA661, MGC161639, DP4

UniProt

Q5H9I0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFDP3 Rabbit Polyclonal Antibody (orb583900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057605

Preservative

Lyophilized powder

AA Sequence

PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V, CF®640R Conjugate
#29014 1x 500 µL

Annexin V, CF®640R Conjugate

Sign In for Pricing
View Details
Amino Nimesulide NAC Adduct Sodium Salt
TRC-A618515-1MG 1 mg

Amino Nimesulide NAC Adduct Sodium Salt

Sign In for Pricing
View Details
REEP3 (NM_001001330) Human Over-expression Lysate
LC400360 20 µg

REEP3 (NM_001001330) Human Over-expression Lysate

Sign In for Pricing
View Details
CAMKIV Antibody
KC-6104-01 50 μL

CAMKIV Antibody

Sign In for Pricing
View Details
CAMKIV Antibody
KC-6104-02 100 µL

CAMKIV Antibody

Sign In for Pricing
View Details
CAMKIV Antibody
KC-6104-03 1 mL

CAMKIV Antibody

Sign In for Pricing
View Details