TFDP3 Peptide - N-terminal region
TFDP3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CT30, E2F-like, HCA661, MGC161639, DP4
UniProt
Q5H9I0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TFDP3 Rabbit Polyclonal Antibody (orb583900) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_057605
Preservative
Lyophilized powder
AA Sequence
PVVGSPNPPSTHFASQNQHSYSSPPWAGQHNRKGEKNGMGLCRLSMKVWE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-E890375-50MG 50 mg
2-Ethenyl-5-oxo-1-pyrrolidinecarboxylic Acid tert-Butyl Ester
Sign In for Pricing
View Details 
TRC-N502501-10MG 10 mg
2-O-(p-Nitrophenyl)-Alpha-D-N-acetylneuraminic Acid, Sodium Salt, X Hydrate
Sign In for Pricing
View Details 
BNCB1993-100 1x 100 µL
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
S1D-C52H5-1mg 1 mg
SARS-CoV-2 S1 protein NTD (A262S), His Tag (MALS verified)
Sign In for Pricing
View Details 
BNC741879-100 1x 100 µL
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details