Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFEB Peptide - middle region

TFEB Peptide - middle region

Product Specifications

Product Name Alternative

AlphaTFEB, TCFEB, BHLHE35, ALPHATFEB

UniProt

P19484

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFEB Rabbit Polyclonal Antibody (orb330957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009093

Preservative

Lyophilized powder

AA Sequence

DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

More Discoveries

Explore Other Products

Browse additional items from our catalog

At2g37450 Antibody
orb798678 2 mg

At2g37450 Antibody

Sign In for Pricing
View Details
Male AB Human Serum Plasma Derived
B2010884 50 mL

Male AB Human Serum Plasma Derived

Sign In for Pricing
View Details
KV9.2 Rabbit Polyclonal Antibody
APRab13171-01 20 µL

KV9.2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KV9.2 Rabbit Polyclonal Antibody
APRab13171-02 50 µL

KV9.2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KV9.2 Rabbit Polyclonal Antibody
APRab13171-03 100 µL

KV9.2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KV9.2 Rabbit Polyclonal Antibody
APRab13171-04 200 µL

KV9.2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details