Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI Peptide - C-terminal region

TFPI Peptide - C-terminal region

Product Specifications

Product Name Alternative

EPI, LACI, TFI, TFPI1

UniProt

P10646

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFPI Rabbit Polyclonal Antibody (orb585526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006278

Preservative

Lyophilized powder

AA Sequence

PFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENND4C Human Pre-designed siRNA Set A
HY-RS03689 1 Set

DENND4C Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human Leptin
26106P-200μg 200 µg

Recombinant Human Leptin

Sign In for Pricing
View Details
Anti-Epac1/RAPGEF3 Antibody Picoband® Fluoro647 Conjugated
A02483-2-Fluoro647 100 µg/Vial

Anti-Epac1/RAPGEF3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Mouse Glucagon ELISA Kit
EMG0021 96 Tests

Mouse Glucagon ELISA Kit

Sign In for Pricing
View Details
KAT7 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61637R-BF488-01 20 µL

KAT7 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
KAT7 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61637R-BF488-02 100 µL

KAT7 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details