Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFPI Peptide - C-terminal region

TFPI Peptide - C-terminal region

Product Specifications

Product Name Alternative

EPI, LACI, TFI, TFPI1

UniProt

P10646

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TFPI Rabbit Polyclonal Antibody (orb585526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006278

Preservative

Lyophilized powder

AA Sequence

PFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIKTKRKRKKQRVK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin L (CTSL) (NM_001257971) Human Untagged Clone
SC332552 10 µg

Cathepsin L (CTSL) (NM_001257971) Human Untagged Clone

Sign In for Pricing
View Details
Sodium-coupled neutral amino Acid Transporter 2 (SLC38A2) Bovine ELISA Kit
H1550 96 Tests

Sodium-coupled neutral amino Acid Transporter 2 (SLC38A2) Bovine ELISA Kit

Sign In for Pricing
View Details
IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (FITC)
MBS6309599-01 0.2 mL

IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (FITC)

Sign In for Pricing
View Details
IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (FITC)
MBS6309599-02 5x 0.2 mL

IGSF6, ID (IGSF6, DORA, Immunoglobulin superfamily member 6, Protein DORA) (FITC)

Sign In for Pricing
View Details
AHSA1 Polyclonal Antibody
MBS9128016-01 0.02 mL

AHSA1 Polyclonal Antibody

Sign In for Pricing
View Details
AHSA1 Polyclonal Antibody
MBS9128016-02 0.1 mL

AHSA1 Polyclonal Antibody

Sign In for Pricing
View Details