Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGDS Peptide - middle region

TGDS Peptide - middle region

Product Specifications

Product Name Alternative

TDPGD, SDR2E1

UniProt

O95455

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGDS Rabbit Polyclonal Antibody (orb325954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055120

Preservative

Lyophilized powder

AA Sequence

DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetylflavaspidic acid
T124934-01 1 mg

Acetylflavaspidic acid

Sign In for Pricing
View Details
Acetylflavaspidic acid
T124934-02 5 mg

Acetylflavaspidic acid

Sign In for Pricing
View Details
MOX1 (MEOX1) Mouse Monoclonal Antibody [Clone 5A3]
E45M16608V-2 50 µL

MOX1 (MEOX1) Mouse Monoclonal Antibody [Clone 5A3]

Sign In for Pricing
View Details
PRDM1 Conjugated Antibody
orb1612284 100 µL

PRDM1 Conjugated Antibody

Sign In for Pricing
View Details
Neurokinin A Receptor Rabbit Polyclonal Antibody (BF750)
orb2559760 100 µL

Neurokinin A Receptor Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Rabbit Polyclonal ENOSF1 Antibody [DyLight 550]
NBP2-99141R 0.1 mL

Rabbit Polyclonal ENOSF1 Antibody [DyLight 550]

Sign In for Pricing
View Details