Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGDS Peptide - middle region

TGDS Peptide - middle region

Product Specifications

Product Name Alternative

TDPGD, SDR2E1

UniProt

O95455

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGDS Rabbit Polyclonal Antibody (orb325954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055120

Preservative

Lyophilized powder

AA Sequence

DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tryptase Beta 2 (TPSb2) ELISA Kit
QY-E21532 96 Tests

Mouse Tryptase Beta 2 (TPSb2) ELISA Kit

Sign In for Pricing
View Details
DDX18P1 sgRNA CRISPR Lentivector (Human) (Target 3)
K0572104 1.0 µg DNA

DDX18P1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PdxK Antibody
orb823738 2 mg

PdxK Antibody

Sign In for Pricing
View Details
Lentiviral mouse Acvr2b shRNA (UAS) - Lentiviral mouse Acvr2b shRNA (UAS, RFP) (25)
GTR15204383 1 Vial

Lentiviral mouse Acvr2b shRNA (UAS) - Lentiviral mouse Acvr2b shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
AHCYL2 ORF Vector (Human) (pORF)
ORF015393 1.0 µg DNA

AHCYL2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tigd5 (NM_178646) Mouse Tagged ORF Clone Lentiviral Particle
MR214775L3V 200 µL

Tigd5 (NM_178646) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details