Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGDS Peptide - middle region

TGDS Peptide - middle region

Product Specifications

Product Name Alternative

TDPGD, SDR2E1

UniProt

O95455

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGDS Rabbit Polyclonal Antibody (orb325954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055120

Preservative

Lyophilized powder

AA Sequence

DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Nucleolar Protein NO38, No-63, mouse mab, SN
651123 5 mL

Anti-Nucleolar Protein NO38, No-63, mouse mab, SN

Sign In for Pricing
View Details
Tbc1d5 Mouse siRNA Oligo Duplex (Locus ID 72238)
SR420361 1 Kit

Tbc1d5 Mouse siRNA Oligo Duplex (Locus ID 72238)

Sign In for Pricing
View Details
STAT2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2300604 1.0 µg DNA

STAT2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Porcine Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit
MBS2601351-01 48 Well

Porcine Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit

Sign In for Pricing
View Details
Porcine Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit
MBS2601351-02 96 Well

Porcine Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit

Sign In for Pricing
View Details
Porcine Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit
MBS2601351-03 5x 96 Well

Porcine Liver Fatty Acid Binding Protein (L-FABP) ELISA Kit

Sign In for Pricing
View Details