Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB2 Peptide - middle region

TGFB2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC116892, TGF-beta2

UniProt

P61812

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGFB2 Rabbit Polyclonal Antibody (orb579467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003229

Preservative

Lyophilized powder

AA Sequence

NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD20 Antibody[BCA/B20]
E-AB-F1045C-01 20 Tests

FITC Anti-Human CD20 Antibody[BCA/B20]

Sign In for Pricing
View Details
FITC Anti-Human CD20 Antibody[BCA/B20]
E-AB-F1045C-02 100 Tests

FITC Anti-Human CD20 Antibody[BCA/B20]

Sign In for Pricing
View Details
FITC Anti-Human CD20 Antibody[BCA/B20]
E-AB-F1045C-03 2x 100 Tests

FITC Anti-Human CD20 Antibody[BCA/B20]

Sign In for Pricing
View Details
Human OR8A1 activation kit by CRISPRa
GA118147 1 Kit

Human OR8A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Hemoglobin subunit gamma 1and2 Antibody [JM84-10]
ET1703-46TR 20 µL

Anti-Hemoglobin subunit gamma 1and2 Antibody [JM84-10]

Sign In for Pricing
View Details
(2S)-N-(2-Boc-amino-3-phenyl-d5-propyl) Boc-glycine
TRC-B621117-1MG 1 mg

(2S)-N-(2-Boc-amino-3-phenyl-d5-propyl) Boc-glycine

Sign In for Pricing
View Details