Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB2 Peptide - middle region

TGFB2 Peptide - middle region

Product Specifications

Product Name Alternative

MGC116892, TGF-beta2

UniProt

P61812

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TGFB2 Rabbit Polyclonal Antibody (orb579467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003229

Preservative

Lyophilized powder

AA Sequence

NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SULt2a2 Mouse Gene Knockout Kit (CRISPR)
KN516967 1 Kit

SULt2a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI18H9]
CF807942 100 µg

PD1 (PDCD1) Mouse Monoclonal Antibody [Clone ID: OTI18H9]

Sign In for Pricing
View Details
Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF405S conjugate, 0.1mg/mL
BNC042243-500 1x 500 µL

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHLPP (PHLPP1) Rabbit Polyclonal Antibody
TA364920 100 µL

PHLPP (PHLPP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vinylcyclohexane (Stabilized by TBC)
TRC-V757080-500MG 500 mg

Vinylcyclohexane (Stabilized by TBC)

Sign In for Pricing
View Details
6 Pyruvic Acid Sodium Salt-13C2
TRC-P998906-50MG 50 mg

6 Pyruvic Acid Sodium Salt-13C2

Sign In for Pricing
View Details