Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tgfb3 Peptide - middle region

Tgfb3 Peptide - middle region

Product Specifications

Product Name Alternative

MGC105479

UniProt

Q07258

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tgfb3 Rabbit Polyclonal Antibody (orb579468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037306

Preservative

Lyophilized powder

AA Sequence

ILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gelsolin Polyclonal Antibody
E-AB-40539-01 25 µL

Gelsolin Polyclonal Antibody

Sign In for Pricing
View Details
Gelsolin Polyclonal Antibody
E-AB-40539-02 100 µL

Gelsolin Polyclonal Antibody

Sign In for Pricing
View Details
SH3PXD2B (NM_001017995) Human Over-expression Lysate
LC422232 20 µg

SH3PXD2B (NM_001017995) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Butylpyrrolidin-2-one
TRC-B700583-50MG 50 mg

1-Butylpyrrolidin-2-one

Sign In for Pricing
View Details
WFDC9 Human Gene Knockout Kit (CRISPR)
KN422677 1 Kit

WFDC9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BPGM Polyclonal Antibody
E-AB-68413-01 60 µL

BPGM Polyclonal Antibody

Sign In for Pricing
View Details