Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tgfb3 Peptide - middle region

Tgfb3 Peptide - middle region

Product Specifications

Product Name Alternative

MGC105479

UniProt

Q07258

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tgfb3 Rabbit Polyclonal Antibody (orb579468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037306

Preservative

Lyophilized powder

AA Sequence

ILRPDEHIAKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse S100 Calcium Binding Protein A6 (S100A6) ELISA Kit
RDR-S100A6-Mu-01 96 Tests

Mouse S100 Calcium Binding Protein A6 (S100A6) ELISA Kit

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A6 (S100A6) ELISA Kit
RDR-S100A6-Mu-02 48 Tests

Mouse S100 Calcium Binding Protein A6 (S100A6) ELISA Kit

Sign In for Pricing
View Details
G 7460
TRC-M783140-50MG 50 mg

G 7460

Sign In for Pricing
View Details
BTLA (BTLA/1528), 0.2mg/mL
BNUB1528-500 1x 500 µL

BTLA (BTLA/1528), 0.2mg/mL

Sign In for Pricing
View Details
Sodium DL-Lactate-d3 (60% w/w in H2O)
TRC-S644002-10MG 10 mg

Sodium DL-Lactate-d3 (60% w/w in H2O)

Sign In for Pricing
View Details
Ashwagandhanolide
TRC-A844530-25MG 25 mg

Ashwagandhanolide

Sign In for Pricing
View Details