TGFB3 Peptide - middle region
TGFB3 Peptide - middle region
Product Specifications
Product Name Alternative
ARVD, FLJ16571, TGF-beta3
UniProt
P10600
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TGFB3 Rabbit Polyclonal Antibody (orb584236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003230
Preservative
Lyophilized powder
AA Sequence
EFRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P-CA-717-01 3 Tests
Mouse Articular Chondrocytes Isolation and Culture Kit
Sign In for Pricing
View Details P-CA-717-02 10 Tests
Mouse Articular Chondrocytes Isolation and Culture Kit
Sign In for Pricing
View Details 
LV722731 1.0 µg DNA
DFNA61 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
Sign In for Pricing
View Details 
MBS6378782-01 0.1 mL
FNDC4 (FRCP1, Fibronectin Type III Domain-containing Protein 4, Fibronectin Type III Repeat-containing Protein 1, FLJ22362, UNQ6389/PRO21134) (FITC)
Sign In for Pricing
View Details MBS6378782-02 5x 0.1 mL
FNDC4 (FRCP1, Fibronectin Type III Domain-containing Protein 4, Fibronectin Type III Repeat-containing Protein 1, FLJ22362, UNQ6389/PRO21134) (FITC)
Sign In for Pricing
View Details