Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THEG Peptide - middle region

THEG Peptide - middle region

Product Specifications

Product Name Alternative

CT56, MGC26138, THEG1

UniProt

Q9P2T0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THEG Rabbit Polyclonal Antibody (orb326236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954672

Preservative

Lyophilized powder

AA Sequence

LKDRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasma Cell Marker (LIV3G11, same as 7B18), CF405S conjugate, 0.1mg/mL
BNC040047-500 1x 500 µL

Plasma Cell Marker (LIV3G11, same as 7B18), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSF (C-term) Rabbit Polyclonal Antibody
AP08714PU-N 100 µL

NSF (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Z-12-Pentacosene (>85%)
TRC-P512150-1MG 1 mg

Z-12-Pentacosene (>85%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS636746 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Triglyme-d6
TRC-T793802-10MG 10 mg

Triglyme-d6

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL
BNC881137-100 1x 100 µL

ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details