Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THEG Peptide - middle region

THEG Peptide - middle region

Product Specifications

Product Name Alternative

CT56, MGC26138, THEG1

UniProt

Q9P2T0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THEG Rabbit Polyclonal Antibody (orb326237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954672

Preservative

Lyophilized powder

AA Sequence

DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMED10 Polyclonal Antibody
E-AB-53096-01 20 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
TMED10 Polyclonal Antibody
E-AB-53096-02 60 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
TMED10 Polyclonal Antibody
E-AB-53096-03 120 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
TMED10 Polyclonal Antibody
E-AB-53096-04 200 µL

TMED10 Polyclonal Antibody

Sign In for Pricing
View Details
S100b Mouse Gene Knockout Kit (CRISPR)
KN515244 1 Kit

S100b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ABY Dye qPCR Calibration Solution *10,000X*
67037-AAT 100 µL

ABY Dye qPCR Calibration Solution *10,000X*

Sign In for Pricing
View Details