Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THEG Peptide - middle region

THEG Peptide - middle region

Product Specifications

Product Name Alternative

CT56, MGC26138, THEG1

UniProt

Q9P2T0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THEG Rabbit Polyclonal Antibody (orb326237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954672

Preservative

Lyophilized powder

AA Sequence

DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Epha2 activation kit by CRISPRa
GA201257 1 Kit

Mouse Epha2 activation kit by CRISPRa

Sign In for Pricing
View Details
IZUMO1 (NM_182575) Human Recombinant Protein
TP306671 20 µg

IZUMO1 (NM_182575) Human Recombinant Protein

Sign In for Pricing
View Details
Incandronate
TRC-I499700-10MG 10 mg

Incandronate

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), Biotin conjugate, 0.1mg/mL
BNCB1992-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL18R Beta (IL18RAP) Human Gene Knockout Kit (CRISPR)
KN421477 1 Kit

IL18R Beta (IL18RAP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLIC3 Rabbit Polyclonal Antibody
HA500316 100 µL

CLIC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details