Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THNSL2 Peptide - middle region

THNSL2 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ10916, TSH2, THS2, SOFAT

UniProt

Q86YJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THNSL2 Rabbit Polyclonal Antibody (orb326156) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060741

Preservative

Lyophilized powder

AA Sequence

LPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5' ROX / 3' BBQ-650
orb1734592 30 to 49 nmol

5' ROX / 3' BBQ-650

Sign In for Pricing
View Details
Cartilage Oligomeric Matrix Protein (COMP) Magnetic Luminex Assay Kit
LKU601066 96 Tests

Cartilage Oligomeric Matrix Protein (COMP) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
TReP-132 CRISPR/Cas9 KO Plasmid (m)
sc-432493 20 µg

TReP-132 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
March8 Protein Vector (Human) (pPB-C-His)
PV025109 500 ng

March8 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CCS Adenovirus (Mouse)
15439054 1.0 mL

CCS Adenovirus (Mouse)

Sign In for Pricing
View Details
E. coli antibody
10-E10A 0.5 mg

E. coli antibody

Sign In for Pricing
View Details