Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Thrb Peptide - N-terminal region

Thrb Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC141269, MGC141270, Nr1a2, T3R[b], T3Rbeta, Thrb1, Thrb2, c-erbAbeta

UniProt

P37242

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Thrb Rabbit Polyclonal Antibody (orb329902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_033406

Preservative

Lyophilized powder

AA Sequence

MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF568 conjugate, 0.1mg/mL
BNC682363-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 Recombinant Rabbit Monoclonal Antibody [PD01-28]
HA721219 100 µL

CD43 Recombinant Rabbit Monoclonal Antibody [PD01-28]

Sign In for Pricing
View Details
Mouse Rac2 activation kit by CRISPRa
GA203544 1 Kit

Mouse Rac2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ZBTB3 activation kit by CRISPRa
GA112670 1 Kit

Human ZBTB3 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody
AN301445L-01 50 µL

Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody
AN301445L-02 100 µL

Recombinant beta-2 Adrenergic Receptor Monoclonal Antibody

Sign In for Pricing
View Details