Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tigd4 Peptide - N-terminal region

Tigd4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C130063O11Rik, Gm418

UniProt

Q8BUZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tigd4 Rabbit Polyclonal Antibody (orb325791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997161

Preservative

Lyophilized powder

AA Sequence

LRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP4K1 Human Gene Knockout Kit (CRISPR)
KN220698 1 Kit

MAP4K1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ATP citrate lyase Recombinant Rabbit Monoclonal Antibody [ST51-07]
ET1609-37 100 µL

ATP citrate lyase Recombinant Rabbit Monoclonal Antibody [ST51-07]

Sign In for Pricing
View Details
D-erythro-Sphingosine-1-phosphate
TRC-S681500-1MG 1 mg

D-erythro-Sphingosine-1-phosphate

Sign In for Pricing
View Details
CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF405S conjugate, 0.1mg/mL
BNC042751-100 1x 100 µL

CD127 / IL7R (Marker of T-Reg Cells) (IL7R/2751), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit
E-OSEL-RB0003-01 24 Tests

QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit
E-OSEL-RB0003-02 48 Tests

QuicKey Pro Rabbit Pg (Progesterone) ELISA Kit

Sign In for Pricing
View Details