Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tigd4 Peptide - N-terminal region

Tigd4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C130063O11Rik, Gm418

UniProt

Q8BUZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tigd4 Rabbit Polyclonal Antibody (orb325791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997161

Preservative

Lyophilized powder

AA Sequence

LRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D3B (NM_001001417) Human Over-expression Lysate
LY424345 100 µg

TBC1D3B (NM_001001417) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant OXCT1 Antibody
RN-10718-01 50 μL

Recombinant OXCT1 Antibody

Sign In for Pricing
View Details
Recombinant OXCT1 Antibody
RN-10718-02 100 µL

Recombinant OXCT1 Antibody

Sign In for Pricing
View Details
Recombinant OXCT1 Antibody
RN-10718-03 1 mL

Recombinant OXCT1 Antibody

Sign In for Pricing
View Details
Xylobiose
TRC-X750400-10MG 10 mg

Xylobiose

Sign In for Pricing
View Details
Human TAS1R3 activation kit by CRISPRa
GA113263 1 Kit

Human TAS1R3 activation kit by CRISPRa

Sign In for Pricing
View Details