Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Timm13 Peptide - N-terminal region

Timm13 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D10Ertd378e, Tim9, Timm9

UniProt

P62075

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Timm13 Rabbit Polyclonal Antibody (orb325940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038923

Preservative

Lyophilized powder

AA Sequence

FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details