Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP2 Peptide - N-terminal region

TIMP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSC-21K, Metalloproteinase inhibitor 2, TIMP2, TIMP metallopeptidase inhibitor 2, Tissue inhibitor of metalloproteinases 2, Timp2

UniProt

P16035

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMP2 Rabbit Polyclonal Antibody (orb584246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003246

Preservative

Lyophilized powder

AA Sequence

NADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RUNDC3A sgRNA gene knockout kit - Lentiviral human RUNDC3A sgRNA gene knockout kit (100)
GTR15356479 1 Vial

Lentiviral human RUNDC3A sgRNA gene knockout kit - Lentiviral human RUNDC3A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rat rno-miR-146a-3p miRNA Agomir
abx884929-01 5 nmol

Rat rno-miR-146a-3p miRNA Agomir

Sign In for Pricing
View Details
Rat rno-miR-146a-3p miRNA Agomir
abx884929-02 10 nmol

Rat rno-miR-146a-3p miRNA Agomir

Sign In for Pricing
View Details
RING finger protein 175 (RNF175) (NM_173662) Human Tagged Lenti ORF Clone
RC206758L3 10 µg

RING finger protein 175 (RNF175) (NM_173662) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human MIEF1 shRNA (UAS) - Lentiviral human MIEF1 shRNA (UAS, RFP) (25)
GTR15309722 1 Vial

Lentiviral human MIEF1 shRNA (UAS) - Lentiviral human MIEF1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
FABP6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV676928 1.0 µg DNA

FABP6 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details