Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP2 Peptide - N-terminal region

TIMP2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSC-21K, Metalloproteinase inhibitor 2, TIMP2, TIMP metallopeptidase inhibitor 2, Tissue inhibitor of metalloproteinases 2, Timp2

UniProt

P16035

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMP2 Rabbit Polyclonal Antibody (orb584246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003246

Preservative

Lyophilized powder

AA Sequence

NADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Skepinone-L
BISN0248 1 mg

Skepinone-L

Sign In for Pricing
View Details
Syncytin-2 shRNA (h) Lentiviral Particles
sc-95207-V 200 µL

Syncytin-2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit anti-CCR10 Antibody
MBS4513836-01 0.05 mL

Rabbit anti-CCR10 Antibody

Sign In for Pricing
View Details
Rabbit anti-CCR10 Antibody
MBS4513836-02 0.1 mL

Rabbit anti-CCR10 Antibody

Sign In for Pricing
View Details
Rabbit anti-CCR10 Antibody
MBS4513836-03 5x 0.1 mL

Rabbit anti-CCR10 Antibody

Sign In for Pricing
View Details
SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (HRP)
MBS6395668-01 0.1 mL

SUMO2 (Small Ubiquitin-related Modifier 2, SUMO-2, HSMT3, SMT3 Homolog 2, SUMO-3, Sentrin-2, Ubiquitin-like Protein SMT3A, Smt3A, SMT3A, SMT3H2) (HRP)

Sign In for Pricing
View Details