Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP2 Peptide - middle region

TIMP2 Peptide - middle region

Product Specifications

Product Name Alternative

CSC-21K, Timp-2, Metalloproteinase inhibitor 2, TIMP2, TIMP metallopeptidase inhibitor 2, Tissue inhibitor of metalloproteinases 2, Timp2

UniProt

P16035

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMP2 Rabbit Polyclonal Antibody (orb584247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_003246

Preservative

Lyophilized powder

AA Sequence

IVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pET-44b(+) Plasmid
PVTY00835 2 µg

pET-44b(+) Plasmid

Sign In for Pricing
View Details
Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit
MBS749695-01 48 Well

Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit

Sign In for Pricing
View Details
Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit
MBS749695-02 96 Well

Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit

Sign In for Pricing
View Details
Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit
MBS749695-03 5x 96 Well

Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit

Sign In for Pricing
View Details
Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit
MBS749695-04 10x 96 Well

Porcine Chemokine C-X-C-Motif Ligand 9 ELISA Kit

Sign In for Pricing
View Details
Goat Polyclonal Kir6.2 Antibody
NBP1-00206 0.1 mg

Goat Polyclonal Kir6.2 Antibody

Sign In for Pricing
View Details