Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Peptide - middle region

TIMP3 Peptide - middle region

Product Specifications

Product Name Alternative

HSMRK222, K222, K222TA2, SFD

UniProt

P48032

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMP3 Rabbit Polyclonal Antibody (orb584248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000353

Preservative

Lyophilized powder

AA Sequence

LVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myristoleic Acid
TRC-M884605-50MG 50 mg

Myristoleic Acid

Sign In for Pricing
View Details
IL3 Antibody
KC-663-01 50 μL

IL3 Antibody

Sign In for Pricing
View Details
IL3 Antibody
KC-663-02 100 µL

IL3 Antibody

Sign In for Pricing
View Details
IL3 Antibody
KC-663-03 1 mL

IL3 Antibody

Sign In for Pricing
View Details
ACK1 (TNK2) (N-term) Rabbit Polyclonal Antibody
AP17080PU-N 400 µL

ACK1 (TNK2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DBP Polyclonal Antibody
E-AB-17882-01 20 µL

DBP Polyclonal Antibody

Sign In for Pricing
View Details