Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Peptide - middle region

TIMP3 Peptide - middle region

Product Specifications

Product Name Alternative

HSMRK222, K222, K222TA2, SFD

UniProt

P48032

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMP3 Rabbit Polyclonal Antibody (orb584248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000353

Preservative

Lyophilized powder

AA Sequence

LVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,5,6-Triaminopyrimidin-4(1H)-one Sulphate
TRC-T896540-5G 5 g

2,5,6-Triaminopyrimidin-4(1H)-one Sulphate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714587 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Amplite® Fluorimetric Acetylcholine Assay Kit *Red Fluorescence*
11403-AAT 200 Tests

Amplite® Fluorimetric Acetylcholine Assay Kit *Red Fluorescence*

Sign In for Pricing
View Details
DDT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
TA505658BM 100 µL

DDT Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS706922 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
myo-Inositol-d6 Trispyrophosphate Hexasodium Salt
TRC-I666022-1MG 1 mg

myo-Inositol-d6 Trispyrophosphate Hexasodium Salt

Sign In for Pricing
View Details