Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Peptide - N-terminal region

TIMP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSMRK222, K222, K222TA2, SFD

UniProt

P35625

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000353

Preservative

Lyophilized powder

AA Sequence

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYY, CT (PYY, Peptide YY, PYY-I, Peptide tyrosine tyrosine, Peptide YY (3-36), PYY-II) (MaxLight 490) discontinued
040714-ML490 100 µL

PYY, CT (PYY, Peptide YY, PYY-I, Peptide tyrosine tyrosine, Peptide YY (3-36), PYY-II) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Anti-BCL2L15 Rabbit mAb
CMA6398-01 30 µL

Recombinant Anti-BCL2L15 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-BCL2L15 Rabbit mAb
CMA6398-02 50 μL

Recombinant Anti-BCL2L15 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-BCL2L15 Rabbit mAb
CMA6398-03 100 µL

Recombinant Anti-BCL2L15 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-BCL2L15 Rabbit mAb
CMA6398-04 200 µL

Recombinant Anti-BCL2L15 Rabbit mAb

Sign In for Pricing
View Details
Syntaxin 8 (Syntaxin-8, STX8, CARB) (AP)
MBS6134056-01 0.1 mL

Syntaxin 8 (Syntaxin-8, STX8, CARB) (AP)

Sign In for Pricing
View Details