Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP3 Peptide - N-terminal region

TIMP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HSMRK222, K222, K222TA2, SFD

UniProt

P35625

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000353

Preservative

Lyophilized powder

AA Sequence

MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-Gln (Trt) -OH-13C5,15N2
HY-W013081S 1 Each

Fmoc-Gln (Trt) -OH-13C5,15N2

Sign In for Pricing
View Details
Anti-Yeast BRE2 Antibody, PE Conjugate
DZ33917-PE 200 µL/Vial

Anti-Yeast BRE2 Antibody, PE Conjugate

Sign In for Pricing
View Details
Lentiviral human TMEM181 sgRNA gene knockout kit - Lentiviral human TMEM181 sgRNA gene knockout kit (plasmid)
GTR15388319 1 Vial

Lentiviral human TMEM181 sgRNA gene knockout kit - Lentiviral human TMEM181 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Lentiviral mouse Mb shRNA (UAS) - Lentiviral mouse Mb shRNA (UAS, RFP) (100)
GTR15301995 1 Vial

Lentiviral mouse Mb shRNA (UAS) - Lentiviral mouse Mb shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Vmn1r132 siRNA Oligos set (Mouse)
49550174 3x 5 nmol

Vmn1r132 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Norescitalopram discontinued
N3950-20 1 mg

Norescitalopram discontinued

Sign In for Pricing
View Details