Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP4 Peptide - middle region

TIMP4 Peptide - middle region

Product Specifications

UniProt

Q99727

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003247

Preservative

Lyophilized powder

AA Sequence

LCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galns Rat siRNA Oligo Duplex (Locus ID 292073)
SR501403 1 Kit

Galns Rat siRNA Oligo Duplex (Locus ID 292073)

Sign In for Pricing
View Details
Recombinant Ehrlichia canis Chaperone protein htpG (htpG), partial
MBS1340921 Inquire

Recombinant Ehrlichia canis Chaperone protein htpG (htpG), partial

Sign In for Pricing
View Details
STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 490) discontinued
S7973-59H-ML490 100 µL

STK40, CT (Sugen Kinase 495, SgK495, SINK-homologous Serine/Threonine-protein Kinase, Serine/Threonine-protein Kinase 40, SGK495, SHIK) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Guinea pig Nurim (NRM) ELISA Kit
MBS7208612-01 48 Well

Guinea pig Nurim (NRM) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Nurim (NRM) ELISA Kit
MBS7208612-02 96 Well

Guinea pig Nurim (NRM) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Nurim (NRM) ELISA Kit
MBS7208612-03 5x 96 Well

Guinea pig Nurim (NRM) ELISA Kit

Sign In for Pricing
View Details