What is the catalog number for TIMP4 Peptide - middle region?

The catalog number for TIMP4 Peptide - middle region is orb2008707.

What sizes are available for TIMP4 Peptide - middle region?

TIMP4 Peptide - middle region is available in the following size(s): 100 µg.

Is TIMP4 Peptide - middle region in stock?

TIMP4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

TIMP4 Peptide - middle region

Product Specifications

UniProt

Q99727

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003247

Preservative

Lyophilized powder

AA Sequence

LCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-149543 10 µM

MPV17 siRNA (m)

Sign In for Pricing

View Details

SI101957A 1 Each

Mouse Ccdc191 Pre-designed siRNA Set A

Sign In for Pricing

View Details

E16HA0142-100 100 Tests

Mouse anti-Human CD14, APC Conjugated mAb.

Sign In for Pricing

View Details

32317141 1x 10^6 Cells / 1.0 mL

Nup153 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing

View Details

RR210711L4 10 µg

Pla2g12a (NM_001108565) Rat Tagged Lenti ORF Clone

Sign In for Pricing

View Details

TU171050 1.0 mL

Trdn 3'UTR GFP Stable Cell Line

Sign In for Pricing

View Details